random toons

Wednesday, February 21, 2007

the Sun & the Moon from the North Pole...


A scene you may never get to see, so take a moment and enjoy!

This is the sunset at the North Pole with the moon at its closest point. And, you also see the sun below the moon.

Tuesday, February 20, 2007

iknowyou'llgetannoyedreadingthisposthasthelongestnameofthenotsolongestpostinmyblog

Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zombified Living Dead Part 2: In Shocking 2-D

Director: Lowell Mason
Year: 1991
Words in title: 41
Characters in title: 208 including spaces, 168 without

Basically this movie is a remake of 'Night of the Living Dead' with a new soundtrack added.

===================================

Some of the Longest Domain Names

http://www.thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com

http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/

http://www.thepersonwithanewideaisacrank-untiltheideasucceeds-by-marktwain.com/

http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com/

===================================


What is the world's longest place name?

A little village in Wales boasts the longest place name at 58 letters:
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch...


...But New Zealand makes the same claim with a hill containing 92 letters:

Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu...
...But after some further digging we found the winner to be Bangkok. OK, so that's only 7 letters, but the official ceremonial name of Bangkok is Krung Thep Mahanakhon for short meaning 'City of Angels'.
The full name of Bangkok has many variations in spelling but we found what is believed to be the official spelling coming in at 163 letters:

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

===================================

Wednesday, February 7, 2007

brain teasers!!

Following are 6 words that have the same two letters repeated at some point. Those two letters have been removed, replaced by two sets of asterisks. Can you figure out which two letters to use in each word? You use the same two letters within each word, but use a different set of letters for each word.

1. **chorm**
2. **joym**t
3. **iqu**te
4. **ip**ape
5. **s**cere
6. **p**zard

====================================

What animal completes this series?

fly, spider, bird, cat, dog, goat, cow, ?

====================================

You are on your way to visit your Grandma, who lives at the end of the valley. It's her birthday, and you want to give her the cakes you've made.Between your house and her house, you have to cross 7 bridges, and as it goes in the land of make believe, there is a troll under every bridge! Each troll, quite rightly, insists that you pay a troll toll. Before you can cross their bridge, you have to give them half of the cakes you are carrying, but as they are kind trolls, they each give you back a single cake.

How many cakes do you have to leave home with to make sure that you arrive at Grandma's with exactly 2 cakes?

====================================

Tuesday, February 6, 2007

Man - Nature...part of a panorama



Sometimes the sky itself is the best show in town. People from Perth, Australia gathered on a local beach to watch a sky light up with delights near and far.

Nearby, fireworks exploded as part of Australia Day celebrations. On the far right, lightning from a thunderstorm flashed in the distance. Near the image center, though, seen through clouds, was the most unusual sight of all: Comet McNaught.