random toons

Friday, September 14, 2007

Planet Survives its Star Becoming a Red Giant


When a star like our own Sun nears the end of its 10 billion year life, it expands up into a red giant, consuming any planets foolish enough to orbit closely. But what happens to the more distant planets?
Astronomers have discovered just such a planet, orbiting a red giant star. Perhaps this gives us hope for the fate of our own planet Earth, when the Sun expands too. Not so fast.

The planet is called V 391 Pegasi b, and before its parent star transformed into the red giant we see today, it orbited at roughly the same distance as the Earth. As the star expanded, its centre of gravity changed, and the planet's orbit spiraled outward, keeping pace with the changing star. Although the star now engulfs a distance comparable between the Sun and the Earth, the planet is now out past the orbit of Mars; takes 3.2 years to complete a full year.
We shouldn't take too much heart in this - this planet is larger than Jupiter, so a smaller planet like the Earth could still be vulnerable. As far as our planets are concerned, we expect Mercury and Venus to disappear in the Sun's envelope, whereas Mars should survive. The fate of the Earth is less clear because its position is really at the limit: it appears more likely that the Earth will not survive the red giant expansion of the sun either, but it is not for sure.

Finding this planet was incredibly laborious work. It took seven years of observations and calculations to confirm its existence. It also marks the first time that a new technique was used to discover planets. Traditionally, astronomers measure the change in a planet's velocity as it's yanked back and forth by the gravity of a large planet using a technique called spectroscopy, where the spectrum of its light shifts. In the case of V391 Pegasus b, the astronomers measured small variations in timing of light coming from the star to determine its velocity.

Tuesday, July 24, 2007

cobra tower - kuwait




Wednesday, July 18, 2007

Planets over Pony Express Lake


Beautiful sunset sky colors are reflected in Pony Express Lake in this twilight skyview from northern Missouri, USA, planet Earth.


Recorded on Monday, a two day old crescent Moon and brilliant planet Venus shine through thin clouds. Joining the conjunction on the right of the Moon's sunlit crescent is fellow wanderer Saturn, with Regulus, alpha star of the constellation Leo, above and right of Venus. Moonlight and Venus light streak the almost-calm lake waters.

Stellar Fireworks

Resembling an aerial fireworks explosion, this dramatic image of the energetic star WR124, taken by the Hubble Space Telescope, reveals that it is surrounded by hot clumps of gas being ejected into space at speeds of over 100,000 miles per hour.

The massive, hot central star is known as a Wolf-Rayet star. The star is 15,000 light-years away, located in the constellation Sagittarius. The picture was taken with Hubble's Wide Field Planetary Camera 2 in March 1997. The image is false-colored to reveal details in the nebula's structure.

Tuesday, July 17, 2007

taj mahal


Monday, March 19, 2007

Surprising Rock


A huge rock in a village of Al-Hassa region, SAUDI ARABIA raises 11 cms. from the ground level once in a year during the month of April and stays elevated for about 30 minutes!!!

They say that 17 years ago, one terrorist was shot dead behind this rock as he was hidden there. This encounter happened in the month of April 1989.

You can see the fresh blood stains on the rock. Most surprisingly, when the rock raises from the ground, these stains become darker, fresher and wet.

Local residents tried to wipe off the stains several times, but after some time it appears again on the rock automatically.

letters to god


















bugging you!!!

Monday, March 5, 2007

March 03, 2007

Was 1 am, in the morning ;-)

I just arrived at my stop after 6 tiring hours of an arse cramping journey. It was the Sector 19-20-32-33 round-about crossing. It's not a code for some secret facility.

I was so fortunate that I didn't find any conveyance to reach my place. Called up my dad in the middle of the night, who himself was asleep after an 8 hour journey, to come and pick me up. Obviously I couldn't walk my 3 km way home at that cold hour. Decided to cover some distance till the time dad arrived.

A black road, another black night, and a biting breeze to freeze me to death. I saw a pack of stray dogs howling.

I noticed the lovely beasts frothing at mouth at something on the road. As I approached the pack, I found nothing else other than my own self that was being growled at by the dogs. It scared the shit out of me. I saw some cyclists coming by to gimme some confidence. It was a sense of security and relief.

Rare vehicles past by before another thing caught my eye. The moon. It was full.

It had a white ring around it. Something like a circle of white smoke creating a faded circumference at a distance from the moon. It was beautiful and astounding. Strange.


The ring around the Moon (HALO) is caused by the refraction of Moonlight from ice crystals at different angles in the upper atmosphere. The shape of the ice crystals results in a focusing of the light into a ring. Since the ice crystals typically have the same shape, hexagonal, the Moon ring is almost always the same size.

Weather Folklore has it that a ring around the moon signifies bad weather is coming, and in many cases this may be true. It is believed that the number of stars within a moon halo indicate the number days before bad weather will arrive. Give it a try the next time you observe a moon halo.

It was a Lunar Eclipse Yesterday. Felt great to witness the marvel.

Sunday, March 4, 2007

Beautiful Ice Festival

Here are spectacular Ice Festival pictures. These pictures are from the Lake Placid, NY Ice Festival. Enjoy!

Lake Placid is a village in New York, near the center of the Town of North Elba and named after an adjacent lake. While the village is a year-round resort, it's likely most known as the site of the 1980 Winter Olympics.Lake Placid also hosted the Winter Olympics in 1932.












Thursday, March 1, 2007

Numbers...

The numbers we all use (1, 2, 3, 4, etc.) are known as "arabic" numbers to distinguish them from the "Roman Numerals" (I, II, III, IV, V, VI, etc). Actually the arabs popularized these numbers but they were originally used by the early phonecian traders to count and keep track of their trading accounts.

Have you ever thought why ......... 1 means "one", and 2 means "two"? The roman numerals are easy to understand but what was the logic behind the phonecian numbers?

It's all about angles !


It's the number of angles. If one writes the numbers down (see below) on a piece of paper in their older forms, one quickly sees why. I have marked the angles with "o"s.
No 1 has one angle. No 2 has two angles. No 3 has three angles... etc. and "O" has no angles



AIRBUS S.A.S 2006









2006 Lamborghini Hamann Gallardo Ventus S1 EVO




Wednesday, February 21, 2007

the Sun & the Moon from the North Pole...


A scene you may never get to see, so take a moment and enjoy!

This is the sunset at the North Pole with the moon at its closest point. And, you also see the sun below the moon.

Tuesday, February 20, 2007

iknowyou'llgetannoyedreadingthisposthasthelongestnameofthenotsolongestpostinmyblog

Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zombified Living Dead Part 2: In Shocking 2-D

Director: Lowell Mason
Year: 1991
Words in title: 41
Characters in title: 208 including spaces, 168 without

Basically this movie is a remake of 'Night of the Living Dead' with a new soundtrack added.

===================================

Some of the Longest Domain Names

http://www.thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com

http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/

http://www.thepersonwithanewideaisacrank-untiltheideasucceeds-by-marktwain.com/

http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com/

===================================


What is the world's longest place name?

A little village in Wales boasts the longest place name at 58 letters:
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch...


...But New Zealand makes the same claim with a hill containing 92 letters:

Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu...
...But after some further digging we found the winner to be Bangkok. OK, so that's only 7 letters, but the official ceremonial name of Bangkok is Krung Thep Mahanakhon for short meaning 'City of Angels'.
The full name of Bangkok has many variations in spelling but we found what is believed to be the official spelling coming in at 163 letters:

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

===================================

Wednesday, February 7, 2007

brain teasers!!

Following are 6 words that have the same two letters repeated at some point. Those two letters have been removed, replaced by two sets of asterisks. Can you figure out which two letters to use in each word? You use the same two letters within each word, but use a different set of letters for each word.

1. **chorm**
2. **joym**t
3. **iqu**te
4. **ip**ape
5. **s**cere
6. **p**zard

====================================

What animal completes this series?

fly, spider, bird, cat, dog, goat, cow, ?

====================================

You are on your way to visit your Grandma, who lives at the end of the valley. It's her birthday, and you want to give her the cakes you've made.Between your house and her house, you have to cross 7 bridges, and as it goes in the land of make believe, there is a troll under every bridge! Each troll, quite rightly, insists that you pay a troll toll. Before you can cross their bridge, you have to give them half of the cakes you are carrying, but as they are kind trolls, they each give you back a single cake.

How many cakes do you have to leave home with to make sure that you arrive at Grandma's with exactly 2 cakes?

====================================

Tuesday, February 6, 2007

Man - Nature...part of a panorama



Sometimes the sky itself is the best show in town. People from Perth, Australia gathered on a local beach to watch a sky light up with delights near and far.

Nearby, fireworks exploded as part of Australia Day celebrations. On the far right, lightning from a thunderstorm flashed in the distance. Near the image center, though, seen through clouds, was the most unusual sight of all: Comet McNaught.